PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn179461
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 493aa    MW: 55813.6 Da    PI: 6.5137
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn179461genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.91.9e-192075257
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                +kR+  t++q+e+Le+++ +++yps+e++ e+A +lgLte+qV+ WF+ rR k+k+
  Achn179461 20 KKRRFKTPSQVEALEKFYSEHKYPSEEMKSEIAGSLGLTEKQVSGWFCHRRLKDKN 75
                89999************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-21575IPR009057Homeodomain-like
SuperFamilySSF466891.24E-17777IPR009057Homeodomain-like
PROSITE profilePS5007116.8441676IPR001356Homeobox domain
SMARTSM003897.4E-201880IPR001356Homeobox domain
CDDcd000863.07E-172077No hitNo description
PfamPF000464.5E-172074IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MVESYAVHSE DNNTPPEKSK KRRFKTPSQV EALEKFYSEH KYPSEEMKSE IAGSLGLTEK  60
QVSGWFCHRR LKDKNSQHGE VPANGRQDRS SGIIQEYVSG HRQDSCSSTK QGNNRHFIPK  120
ELESRRFTGQ DYSAADLAYE HGHDPNGNDS DTSSESSLPL QYRVHHQNGD PFDMATSRYL  180
PQDENMPPIN SMGIRPRIGP SGYLKVKVPV ENVAITAVKR QLGRHYREDG PALGVEFDPL  240
PPGAFESSNK DPVNEPCHLG DPDLRPSPDF SRIYSQPNTS MRYQVYNSKM SSQDADLEGS  300
SFKIMRRFDP CENSIGHQPK PKPILPNRTN PFPGWNSSIE MDEASAGEIP VYGSCKMRAK  360
PDLEGRRRVS VSRHHLHPYG YQVTDGQREE PWLCDTYAVT TEDAHREHFE SKYSNITRKP  420
REALDMKDIE LSRRMAKVAN GCWDEFPQQQ CAKEALMGER RQWTNTIKRS AVDDQPSSFS  480
EDETAEASSS LD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11924KKRRFK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279963.21e-144PREDICTED: uncharacterized protein LOC100265339
TrEMBLF6HA211e-144F6HA21_VITVI; Putative uncharacterized protein
STRINGVIT_06s0009g03530.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34362242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.14e-62HB-other family protein